(data stored in ACNUC7421 zone)

EMBL: CP000247.PE459

CP000247.PE459       Location/Qualifiers
FT   CDS             494777..495109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0466"
FT                   /product="probable transmembrane protein YajC"
FT                   /note="preprotein translocase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68497"
FT                   /db_xref="GOA:A0A454A1S8"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1S8"
FT                   /protein_id="ABG68497.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
     MSFFISDAVA ATGAPAQGSP MSLILMLVVF GLIFYFMILR PQQKRTKEHK KLMDSIAKGD        60
     EVLTNGGLVG RVTKVAENGY IAIALNDTTE VVIKRDFVAA VLPKGTMKAL                  110
//

If you have problems or comments...

PBIL Back to PBIL home page