(data stored in ACNUC7421 zone)

EMBL: CP000247.PE461

CP000247.PE461       Location/Qualifiers
FT   CDS             496950..497966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0468"
FT                   /product="protein-export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68499"
FT                   /db_xref="GOA:A0A454A1R6"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1R6"
FT                   /protein_id="ABG68499.1"
FT                   /translation="MAASASRSCQSEECDVAQEYTVEQLNHGRKVYDFMRWDYWAFGIS
FT                   GLLLIAAIVIMGVRGFNWGLDFTGGTVIEITLEKPAEIDVMRDALQKAGFEEPMLQNFG
FT                   SSHDIMVRMPPAEGETGGQVLGSQVLKVINESTNQNAAVKRIEFVGPSVGADLAQTGAM
FT                   ALMAALLSILVYVGFRFEWRLAAGVVIALAHDVIITLGILSLFHIEIDLTIVASLMSVI
FT                   GYSLNDSIVVSDRIRENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLMVILMLYLFG
FT                   GPVLEGFSLTMLIGVSIGTASSIYVASALALKLGMKREHMLQQKVEKEGADQPSILP"
     MAASASRSCQ SEECDVAQEY TVEQLNHGRK VYDFMRWDYW AFGISGLLLI AAIVIMGVRG        60
     FNWGLDFTGG TVIEITLEKP AEIDVMRDAL QKAGFEEPML QNFGSSHDIM VRMPPAEGET       120
     GGQVLGSQVL KVINESTNQN AAVKRIEFVG PSVGADLAQT GAMALMAALL SILVYVGFRF       180
     EWRLAAGVVI ALAHDVIITL GILSLFHIEI DLTIVASLMS VIGYSLNDSI VVSDRIRENF       240
     RKIRRGTPYE IFNVSLTQTL HRTLITSGTT LMVILMLYLF GGPVLEGFSL TMLIGVSIGT       300
     ASSIYVASAL ALKLGMKREH MLQQKVEKEG ADQPSILP                               338
//

If you have problems or comments...

PBIL Back to PBIL home page