(data stored in ACNUC7421 zone)

EMBL: CP000247.PE463

CP000247.PE463       Location/Qualifiers
FT   CDS             complement(498481..499365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0470"
FT                   /product="nucleoside-specific channel-forming protein tsx
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68501"
FT                   /db_xref="GOA:A0A454A1U2"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1U2"
FT                   /protein_id="ABG68501.1"
FT                   /translation="MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSDWWHQSVNVVGSY
FT                   HTRFGPQLRNDTYLEYEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEP
FT                   RFSIDKLTNTDLSFGPFKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSM
FT                   NVYAKYQWQNYGAANENEWDGYRFKVKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSG
FT                   YANNGIKTRTNNSIASSHILALNYDHWHYSVVARYWHNGGQWNDDAELNFGNGNFNVRS
FT                   TGWGGYLVVGYNF"
     MKKTLLAAGA VLALSSSFTV NAAENDKPQY LSDWWHQSVN VVGSYHTRFG PQLRNDTYLE        60
     YEAFAKKDWF DFYGYADAPV FFGGNSDAKG IWNHGSPLFM EIEPRFSIDK LTNTDLSFGP       120
     FKEWYFANNY IYDMGRNKDG RQSTWYMGLG TDIDTGLPMS LSMNVYAKYQ WQNYGAANEN       180
     EWDGYRFKVK YFVPITDLWG GQLSYIGFTN FDWGSDLGDD SGYANNGIKT RTNNSIASSH       240
     ILALNYDHWH YSVVARYWHN GGQWNDDAEL NFGNGNFNVR STGWGGYLVV GYNF             294
//

If you have problems or comments...

PBIL Back to PBIL home page