(data stored in ACNUC7421 zone)

EMBL: CP000247.PE468

CP000247.PE468       Location/Qualifiers
FT   CDS             502489..502908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0475"
FT                   /product="N utilization substance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68506"
FT                   /db_xref="GOA:Q0TKM5"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TKM5"
FT                   /protein_id="ABG68506.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDV
FT                   LYFRELLAGVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAI
FT                   NEAIELAKSFGAEDSHKFVNGVLDKAAPVIRPNKK"
     MKPAARRRAR ECAVQALYSW QLSQNDIADV EYQFLAEQDV KDVDVLYFRE LLAGVATNTA        60
     YLDGLMKPYL SRLLEELGQV EKAVLRIALY ELSKRSDVPY KVAINEAIEL AKSFGAEDSH       120
     KFVNGVLDKA APVIRPNKK                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page