(data stored in ACNUC7421 zone)

EMBL: CP000247.PE483

CP000247.PE483       Location/Qualifiers
FT   CDS             complement(515274..515888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0490"
FT                   /product="cytochrome O ubiquinol oxidase subunit III"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68519"
FT                   /db_xref="GOA:A0A454A1T2"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1T2"
FT                   /protein_id="ABG68519.1"
FT                   /translation="MATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFA
FT                   TYAVLVNGTAGGPTGKDIFELPFVLVETFFLLFSSITYGMAAIAMYKNNKSQVISWLAL
FT                   TWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQ
FT                   IARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM"
     MATDTLTHAT AHAHEHGHHD AGGTKIFGFW IYLMSDCILF SILFATYAVL VNGTAGGPTG        60
     KDIFELPFVL VETFFLLFSS ITYGMAAIAM YKNNKSQVIS WLALTWLFGA GFIGMEIYEF       120
     HHLIVNGMGP DRSGFLSAFF ALVGTHGLHV TSGLIWMAVL MVQIARRGLT STNRTRIMCL       180
     SLFWHFLDVV WICVFTVVYL MGAM                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page