(data stored in ACNUC7421 zone)

EMBL: CP000247.PE488

CP000247.PE488       Location/Qualifiers
FT   CDS             521700..522017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0495"
FT                   /product="BolA protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68524"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1R8"
FT                   /protein_id="ABG68524.1"
FT                   /translation="MMIRERIEEKLRAAFQPVFLEVVDESYRHNVPAGSESHFKVVLVS
FT                   DRFTGERFLNRHRMIYSTLAEELSTTVHALALHTYTIKEWEGLQDTVFASPPCRGAGSI
FT                   A"
     MMIRERIEEK LRAAFQPVFL EVVDESYRHN VPAGSESHFK VVLVSDRFTG ERFLNRHRMI        60
     YSTLAEELST TVHALALHTY TIKEWEGLQD TVFASPPCRG AGSIA                       105
//

If you have problems or comments...

PBIL Back to PBIL home page