(data stored in ACNUC7421 zone)

EMBL: CP000247.PE489

CP000247.PE489       Location/Qualifiers
FT   CDS             522026..522214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1V1"
FT                   /protein_id="ABG68525.1"
FT                   /translation="MQLSALFQYVAKDFMKNGLRAVLFCLDFALFAQHSDENRPGIVKK
FT                   YATARNNRSRLIKVMPL"
     MQLSALFQYV AKDFMKNGLR AVLFCLDFAL FAQHSDENRP GIVKKYATAR NNRSRLIKVM        60
     PL                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page