(data stored in ACNUC7421 zone)

EMBL: CP000247.PE497

CP000247.PE497       Location/Qualifiers
FT   CDS             531642..532040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0504"
FT                   /product="hypothetical protein YbaW (thioesterase
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68533"
FT                   /db_xref="GOA:A0A454A1X5"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1X5"
FT                   /protein_id="ABG68533.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWHGLENSDSFHWMT
FT                   AHNIAFVVVNININYRRPAVLSDLLTITSQLQQLNGKSGILSQVITLEPEGQVVADALI
FT                   TFVCIDLKTQKALALEGELREKLEQMVK"
     MQTQIKVRGY HLDVYQHVNN ARYLEFLEEA RWHGLENSDS FHWMTAHNIA FVVVNININY        60
     RRPAVLSDLL TITSQLQQLN GKSGILSQVI TLEPEGQVVA DALITFVCID LKTQKALALE       120
     GELREKLEQM VK                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page