(data stored in ACNUC7421 zone)

EMBL: CP000247.PE501

CP000247.PE501       Location/Qualifiers
FT   CDS             535539..536081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0508"
FT                   /product="hypothetical transcriptional regulator protein
FT                   YbaO AsnC familiy"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68537"
FT                   /db_xref="GOA:A0A454A1V9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1V9"
FT                   /protein_id="ABG68537.1"
FT                   /translation="MLKPHRINCRDFTFKIELKEKKILCGRAMLDKIDRKLLALLQQDC
FT                   TLSLQALAEAVNLTTTPCWKRLKRLEDDGILIGKVALLDPEKIGLGLTAFVLIKTQHHS
FT                   SEWYCRFVTVVTEMPEVLGFWRMAGEYDYLMRVQVADMKRYDEFYKRLVNSVPGLSDVT
FT                   SSFAMEQIKYTTSLPIE"
     MLKPHRINCR DFTFKIELKE KKILCGRAML DKIDRKLLAL LQQDCTLSLQ ALAEAVNLTT        60
     TPCWKRLKRL EDDGILIGKV ALLDPEKIGL GLTAFVLIKT QHHSSEWYCR FVTVVTEMPE       120
     VLGFWRMAGE YDYLMRVQVA DMKRYDEFYK RLVNSVPGLS DVTSSFAMEQ IKYTTSLPIE       180
//

If you have problems or comments...

PBIL Back to PBIL home page