(data stored in ACNUC7421 zone)

EMBL: CP000247.PE504

CP000247.PE504       Location/Qualifiers
FT   CDS             539838..540176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0511"
FT                   /product="nitrogen regulatory protein P-II 2"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68540"
FT                   /db_xref="GOA:A0A454A1X3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1X3"
FT                   /protein_id="ABG68540.1"
FT                   /translation="MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAEL
FT                   YRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRT
FT                   GEADEAAL"
     MKLVTVIIKP FKLEDVREAL SSIGIQGLTV TEVKGFGRQK GHAELYRGAE YSVNFLPKVK        60
     IDVAIADDQL DEVIDIVSKA AYTGKIGDGK IFVAELQRVI RIRTGEADEA AL               112
//

If you have problems or comments...

PBIL Back to PBIL home page