(data stored in ACNUC7421 zone)

EMBL: CP000247.PE507

CP000247.PE507       Location/Qualifiers
FT   CDS             542619..543053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0514"
FT                   /product="hypothetical protein"
FT                   /note="similar to N-terminal part of lipoprotein YbaY"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68543"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1Y2"
FT                   /protein_id="ABG68543.1"
FT                   /translation="MKLVHMASGLAVAIALAACADQSADIQTPAPAANTSISATQQPAI
FT                   QQPNVSGTVWIRQKVALPPDAVLTVTLSDASLADAPSKVLAQKAVRTEGKQSPFSFVLP
FT                   FNPADVQPNARILLSAAITVNDKLVFITDTVQPVINQWRN"
     MKLVHMASGL AVAIALAACA DQSADIQTPA PAANTSISAT QQPAIQQPNV SGTVWIRQKV        60
     ALPPDAVLTV TLSDASLADA PSKVLAQKAV RTEGKQSPFS FVLPFNPADV QPNARILLSA       120
     AITVNDKLVF ITDTVQPVIN QWRN                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page