(data stored in ACNUC7421 zone)

EMBL: CP000247.PE510

CP000247.PE510       Location/Qualifiers
FT   CDS             543913..544266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0517"
FT                   /product="hypothetical protein YbaA"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68546"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1U8"
FT                   /protein_id="ABG68546.1"
FT                   /translation="MKYVDGFVVAVPADKKDAYREMAAKAAPLFKEFGALRIVECWASD
FT                   VPDGKVTDFRMAVKAEENEEVVFSWIEYPSKEVRDAANQKMISDPRMKEFGESMPFDGK
FT                   RMIYGGFESIIDE"
     MKYVDGFVVA VPADKKDAYR EMAAKAAPLF KEFGALRIVE CWASDVPDGK VTDFRMAVKA        60
     EENEEVVFSW IEYPSKEVRD AANQKMISDP RMKEFGESMP FDGKRMIYGG FESIIDE          117
//

If you have problems or comments...

PBIL Back to PBIL home page