(data stored in ACNUC7421 zone)

EMBL: CP000247.PE518

CP000247.PE518       Location/Qualifiers
FT   CDS             553056..553649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0525"
FT                   /product="putative TetR-family transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68554"
FT                   /db_xref="GOA:A0A454A1T8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1T8"
FT                   /protein_id="ABG68554.1"
FT                   /translation="MALRLFSQQGVSSTSLGEIAKAAGVTRGAIYWHFKDKSDLFSEIW
FT                   ELSESNIGELELEYQAKFPGDPLSVLREILIHVLESTVTEERRRLLMEIIFHKCEFVGE
FT                   MAVVQQAQRNLCLESYDRIEQTLKHCIEAKMLPADLMTRRAAIIMRGYISGLMENWLFA
FT                   PQSFDLKKEARDYVAILLEMYLLCPTLRNPATNE"
     MALRLFSQQG VSSTSLGEIA KAAGVTRGAI YWHFKDKSDL FSEIWELSES NIGELELEYQ        60
     AKFPGDPLSV LREILIHVLE STVTEERRRL LMEIIFHKCE FVGEMAVVQQ AQRNLCLESY       120
     DRIEQTLKHC IEAKMLPADL MTRRAAIIMR GYISGLMENW LFAPQSFDLK KEARDYVAIL       180
     LEMYLLCPTL RNPATNE                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page