(data stored in ACNUC7421 zone)

EMBL: CP000247.PE522

CP000247.PE522       Location/Qualifiers
FT   CDS             558123..558500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0529"
FT                   /product="hypothetical protein YbaN"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68558"
FT                   /db_xref="GOA:A0A454A1X0"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1X0"
FT                   /protein_id="ABG68558.1"
FT                   /translation="MQRIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPR
FT                   FHAWLLYRSWFGSYLRFWQKHHAMPRGAKPRAILLILITFTISLWFVQMPWVRIMLLVI
FT                   LACLLFYMWRIPVIDEKQEKH"
     MQRIILIIIG WLAVVLGTLG VVLPVLPTTP FILLAAWCFA RSSPRFHAWL LYRSWFGSYL        60
     RFWQKHHAMP RGAKPRAILL ILITFTISLW FVQMPWVRIM LLVILACLLF YMWRIPVIDE       120
     KQEKH                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page