(data stored in ACNUC7421 zone)

EMBL: CP000247.PE526

CP000247.PE526       Location/Qualifiers
FT   CDS             561646..562251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0533"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68562"
FT                   /db_xref="GOA:Q0TKG9"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TKG9"
FT                   /protein_id="ABG68562.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   TLTRAMSEIGHCADCRTFTEQEVCNICSNPRRKENGQICVVESPADIYAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQ
FT                   YDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF"
     MQTSPLLTQL MEALRCLPGV GPKSAQRMAF TLLQRDRSGG MRLAQTLTRA MSEIGHCADC        60
     RTFTEQEVCN ICSNPRRKEN GQICVVESPA DIYAIEQTGQ FSGRYFVLMG HLSPLDGIGP       120
     DDIGLDRLEQ RLAEEKITEV ILATNPTVEG EATANYIAEL CAQYDVEASR IAHGVPVGGE       180
     LEMVDGTTLS HSLAGRHKIR F                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page