(data stored in ACNUC7421 zone)

EMBL: CP000247.PE528

CP000247.PE528       Location/Qualifiers
FT   CDS             564416..565060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0535"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68564"
FT                   /db_xref="GOA:Q0TKG7"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TKG7"
FT                   /protein_id="ABG68564.1"
FT                   /translation="MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
FT                   GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVD
FT                   YVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEET
FT                   VRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRAALEKILG"
     MRIILLGAPG AGKGTQAQFI MEKYGIPQIS TGDMLRAAVK SGSELGKQAK DIMDAGKLVT        60
     DELVIALVKE RIAQEDCRNG FLLDGFPRTI PQADAMKEAG INVDYVLEFD VPDELIVDRI       120
     VGRRVHAPSG RVYHVKFNPP KVEGKDDVTG EELTTRKDDQ EETVRKRLVE YHQMTAPLIG       180
     YYSKEAEAGN TKYAKVDGTK PVAEVRAALE KILG                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page