(data stored in ACNUC7421 zone)

EMBL: CP000247.PE537

CP000247.PE537       Location/Qualifiers
FT   CDS             complement(575049..575528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0544"
FT                   /product="protein YbaK / prolyl-tRNA synthetases associated
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68573"
FT                   /db_xref="GOA:A0A454A204"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A204"
FT                   /protein_id="ABG68573.1"
FT                   /translation="MTPAVKLLEKNKISFQIHTYEHDPAETNFGDEVVKKLGLNPDQVY
FT                   KTLLVAVNGDMKHLAVAVTPVAGQLDLKKVAKALGAKKVEMADPMVAQRSTGYLVGGIS
FT                   PLGQKKRLPTIIDAPAQEFATIYVSGGKRGLDIELAASDLAKILDAKFADIARRD"
     MTPAVKLLEK NKISFQIHTY EHDPAETNFG DEVVKKLGLN PDQVYKTLLV AVNGDMKHLA        60
     VAVTPVAGQL DLKKVAKALG AKKVEMADPM VAQRSTGYLV GGISPLGQKK RLPTIIDAPA       120
     QEFATIYVSG GKRGLDIELA ASDLAKILDA KFADIARRD                              159
//

If you have problems or comments...

PBIL Back to PBIL home page