(data stored in ACNUC7421 zone)

EMBL: CP000247.PE544

CP000247.PE544       Location/Qualifiers
FT   CDS             581098..582390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0551"
FT                   /product="hypothetical amino acid transporter YbaT protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68580"
FT                   /db_xref="GOA:A0A454A203"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A203"
FT                   /protein_id="ABG68580.1"
FT                   /translation="MMNTEGNNGNKPLGLWNVVSIGIGAMVGAGIFALLGQAALLMEAS
FT                   TWVAFAFGGIVAMFSGYAYARLGASYPSNGGIIDFFRRGLGNGVFSLALSLLYLLTLAV
FT                   SIAMVARAFGAYAVQFLHEGSQEEHLILLYALGIIAVMTLFNSLSNHAVGRLEVILVGI
FT                   KMMILLLLIIAGVWSLQPAHISVSAPPSSGAFFSCIGITFLAYAGFGMMANAADKVKDP
FT                   EVIMPRAFLVAIGVTTLLYISLALVLLSDVSALELEKYADTAVAQAASPLLGHVGYVIV
FT                   VIGALLATASAINANLFAVFNIMDNMGSERELPKLMNKPLWRQSTWGNIIVVVLIMLMT
FT                   AALNLGSLASVASATFLICYLAVFVVAIRLRHDIHASLPILIVGTLVMLLVIVGFIYSL
FT                   WSQGSRALIWIIGALLLSLIVAMVMKRNKTV"
     MMNTEGNNGN KPLGLWNVVS IGIGAMVGAG IFALLGQAAL LMEASTWVAF AFGGIVAMFS        60
     GYAYARLGAS YPSNGGIIDF FRRGLGNGVF SLALSLLYLL TLAVSIAMVA RAFGAYAVQF       120
     LHEGSQEEHL ILLYALGIIA VMTLFNSLSN HAVGRLEVIL VGIKMMILLL LIIAGVWSLQ       180
     PAHISVSAPP SSGAFFSCIG ITFLAYAGFG MMANAADKVK DPEVIMPRAF LVAIGVTTLL       240
     YISLALVLLS DVSALELEKY ADTAVAQAAS PLLGHVGYVI VVIGALLATA SAINANLFAV       300
     FNIMDNMGSE RELPKLMNKP LWRQSTWGNI IVVVLIMLMT AALNLGSLAS VASATFLICY       360
     LAVFVVAIRL RHDIHASLPI LIVGTLVMLL VIVGFIYSLW SQGSRALIWI IGALLLSLIV       420
     AMVMKRNKTV                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page