(data stored in ACNUC7421 zone)

EMBL: CP000247.PE567

CP000247.PE567       Location/Qualifiers
FT   CDS             604592..605737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0574"
FT                   /product="glycerate kinase 1"
FT                   /EC_number="2.7.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68603"
FT                   /db_xref="GOA:A0A454A230"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A230"
FT                   /protein_id="ABG68603.1"
FT                   /translation="MKIVIAPDSFKESLSAEKCCQAIKAGFSTIFPDAHYICLPIADGG
FT                   EGTVDAMVAATGGNIVTLEVCGPMGETVNAFYGLTGDGKTAVIEMAAASGLMLVAPEKR
FT                   NPLLASSFGTGELIRHALDNGIRHIILGIGGSATVDGGMGMAQALGVRFLDADGQVLAA
FT                   NGGNLARVASIEMDECDPRLANCHIEVACDVDNPLVGARGAAAVFGPQKGATPEMVEEL
FT                   EQGLQNYARVLQQLTEINVCQMAGGGAAGGMGIAAAVFLNADIKPGIEIVLNAVNLAQA
FT                   VQGAALVITGEGRIDSQTAGGKAPLGVASVAKQFNVPVIGIAGVLGDGVEVVHQYGIDA
FT                   VFSILPRLAPLAEVLASGETNLFNSARNIACAIKIGQGIKN"
     MKIVIAPDSF KESLSAEKCC QAIKAGFSTI FPDAHYICLP IADGGEGTVD AMVAATGGNI        60
     VTLEVCGPMG ETVNAFYGLT GDGKTAVIEM AAASGLMLVA PEKRNPLLAS SFGTGELIRH       120
     ALDNGIRHII LGIGGSATVD GGMGMAQALG VRFLDADGQV LAANGGNLAR VASIEMDECD       180
     PRLANCHIEV ACDVDNPLVG ARGAAAVFGP QKGATPEMVE ELEQGLQNYA RVLQQLTEIN       240
     VCQMAGGGAA GGMGIAAAVF LNADIKPGIE IVLNAVNLAQ AVQGAALVIT GEGRIDSQTA       300
     GGKAPLGVAS VAKQFNVPVI GIAGVLGDGV EVVHQYGIDA VFSILPRLAP LAEVLASGET       360
     NLFNSARNIA CAIKIGQGIK N                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page