(data stored in ACNUC7421 zone)

EMBL: CP000247.PE571

CP000247.PE571       Location/Qualifiers
FT   CDS             609285..610952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0578"
FT                   /product="FdrA protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68607"
FT                   /db_xref="GOA:A0A454A215"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A215"
FT                   /protein_id="ABG68607.1"
FT                   /translation="MIHAFIKKGCFQDSVSLMIISRKLSESENVDDVSVMMGTPANKAL
FT                   LDTTGFWHDDFNNATPNDICVAIRSEAADAGIAQAVMQQLEEALKQLAQGSGSSQALTQ
FT                   VRRWDSACQKLPDANLALISVAGEYAAELANQALDRNLNVMMFSDNVTLEDEIQLKTRA
FT                   REKGLLVMGPDCGTSMIAATPLAFANVMPEGNIGVIGASGTGIQELCSQIALAGEGITH
FT                   AIGLGGRDLSREVGGISALTALEMLSADEKSEVLAFVSKPPAETVRLKIVNAMKATGKP
FT                   TVALFLGYTPAVARDENVWFASSLDEAARLACLLSRVTARRNAIAPVSSGFICGLYTGG
FT                   TLAAEAAGLLAGHLGVEADDTHQHGMMLDADGHQILDLGDDFYTVGRPHPMIDPTLRNL
FT                   LIADLGAKPQVRVLLLDVVIGFGATADPAASLVSAWQKACAARSDNQPLYAIATVTGTE
FT                   RDPQCRSQQIATLEDAGIAVVSSLPEATLLAAALIHPLSPATQQHTPSLLENVAVINIG
FT                   LRSFALELQSASKPVVHYQWSPIAGGNKKLARLLERLQ"
     MIHAFIKKGC FQDSVSLMII SRKLSESENV DDVSVMMGTP ANKALLDTTG FWHDDFNNAT        60
     PNDICVAIRS EAADAGIAQA VMQQLEEALK QLAQGSGSSQ ALTQVRRWDS ACQKLPDANL       120
     ALISVAGEYA AELANQALDR NLNVMMFSDN VTLEDEIQLK TRAREKGLLV MGPDCGTSMI       180
     AATPLAFANV MPEGNIGVIG ASGTGIQELC SQIALAGEGI THAIGLGGRD LSREVGGISA       240
     LTALEMLSAD EKSEVLAFVS KPPAETVRLK IVNAMKATGK PTVALFLGYT PAVARDENVW       300
     FASSLDEAAR LACLLSRVTA RRNAIAPVSS GFICGLYTGG TLAAEAAGLL AGHLGVEADD       360
     THQHGMMLDA DGHQILDLGD DFYTVGRPHP MIDPTLRNLL IADLGAKPQV RVLLLDVVIG       420
     FGATADPAAS LVSAWQKACA ARSDNQPLYA IATVTGTERD PQCRSQQIAT LEDAGIAVVS       480
     SLPEATLLAA ALIHPLSPAT QQHTPSLLEN VAVINIGLRS FALELQSASK PVVHYQWSPI       540
     AGGNKKLARL LERLQ                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page