(data stored in ACNUC7421 zone)

EMBL: CP000247.PE575

CP000247.PE575       Location/Qualifiers
FT   CDS             complement(614070..615137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0582"
FT                   /product="phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68611"
FT                   /db_xref="GOA:A0A454A231"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A231"
FT                   /protein_id="ABG68611.1"
FT                   /translation="MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSV
FT                   ITAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLSERS
FT                   EWPAVFDRLGELAIVKRRTGGYDGRGQWRLRADETEQLPAECYGECIVEQGINFSGEVS
FT                   LVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQLQAQAEEMLSAIMQELSYVGV
FT                   MAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSV
FT                   MINLIGSDLNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLP
FT                   PEYASGVMWAQSKFS"
     MKQVCVLGNG QLGRMLRQAG EPLGIAVWPV GLDAEPAAVP FQQSVITAEI ERWPETALTR        60
     ELARHPAFVN RDVFPIIADR LTQKQLFDKL HLPTAPWQLL SERSEWPAVF DRLGELAIVK       120
     RRTGGYDGRG QWRLRADETE QLPAECYGEC IVEQGINFSG EVSLVGARGF DGSTVFYPLT       180
     HNLHQDGILR TSVAFPQANA QLQAQAEEML SAIMQELSYV GVMAMECFVT PQGLLINELA       240
     PRVHNSGHWT QNGASISQFE LHLRAITDLP LPQPVVNNPS VMINLIGSDL NYDWLKLPLV       300
     HLHWYDKEVR PGRKVGHLNL TDSDTSRLTA TLEALIPLLP PEYASGVMWA QSKFS            355
//

If you have problems or comments...

PBIL Back to PBIL home page