(data stored in ACNUC7421 zone)

EMBL: CP000247.PE584

CP000247.PE584       Location/Qualifiers
FT   CDS             620744..620941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A243"
FT                   /protein_id="ABG68620.1"
FT                   /translation="MSILSEAWRAVSFRFLKSKTFCTWLIHTYHDNRRWFAAIVSYIRC
FT                   GRTLVQQLVQKPLTQQGLTV"
     MSILSEAWRA VSFRFLKSKT FCTWLIHTYH DNRRWFAAIV SYIRCGRTLV QQLVQKPLTQ        60
     QGLTV                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page