(data stored in ACNUC7421 zone)

EMBL: CP000247.PE586

CP000247.PE586       Location/Qualifiers
FT   CDS             complement(621386..621685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0594"
FT                   /product="putative DNA integration/recombination/invertion
FT                   protein"
FT                   /note="similar to N-terminal prophage DLP12 integrase"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68622"
FT                   /db_xref="GOA:A0A454A247"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A247"
FT                   /protein_id="ABG68622.1"
FT                   /translation="MRCNGTRDLQKNQAKRLIDESPEPLKSVVKFALVTVLRKSNIINL
FT                   EWQQIDMQRQVARVNPEDSKSNRAIGVALNDTASKVLHDQTGKHHKCGCTYQGG"
     MRCNGTRDLQ KNQAKRLIDE SPEPLKSVVK FALVTVLRKS NIINLEWQQI DMQRQVARVN        60
     PEDSKSNRAI GVALNDTASK VLHDQTGKHH KCGCTYQGG                               99
//

If you have problems or comments...

PBIL Back to PBIL home page