(data stored in ACNUC7421 zone)

EMBL: CP000247.PE595

CP000247.PE595       Location/Qualifiers
FT   CDS             633119..634501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0603"
FT                   /product="probable outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68631"
FT                   /db_xref="GOA:A0A454A250"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A250"
FT                   /protein_id="ABG68631.1"
FT                   /translation="MSPCKLLPFCVALALTGCSLAPDYQRPAMPVPQQFSLSQNGLVNA
FT                   ADNYQNAGWRTFFVDNQVKTLISEALVNNRDLRMAALKVQEARAQYRLTDADRYPQLNG
FT                   EGSGSWSGNLKGDSATTRELSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHI
FT                   LLVSNVAQSYFNQQLAYAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIE
FT                   STRSDIAKRQGELAQANNALQLLLGSYGKLPQAQTVNSDSLQSVKLPAGLPSQILLQRP
FT                   DIMEAEHALMAANANIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEI
FT                   PIFNAGRNQANLDIAEIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLA
FT                   SLQITLQRARTLYQHGAVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGW
FT                   QQ"
     MSPCKLLPFC VALALTGCSL APDYQRPAMP VPQQFSLSQN GLVNAADNYQ NAGWRTFFVD        60
     NQVKTLISEA LVNNRDLRMA ALKVQEARAQ YRLTDADRYP QLNGEGSGSW SGNLKGDSAT       120
     TRELSTGLNA SFDLDFFGRL KNMSEAERQN YLATEEAQRA VHILLVSNVA QSYFNQQLAY       180
     AQLQIAEETL RNYQQSYAFV EKQLLTGSSN VLALEQARGV IESTRSDIAK RQGELAQANN       240
     ALQLLLGSYG KLPQAQTVNS DSLQSVKLPA GLPSQILLQR PDIMEAEHAL MAANANIGAA       300
     RAAFFPSISL TSGISTASSD LSSLFNASSG MWNFIPKIEI PIFNAGRNQA NLDIAEIRQQ       360
     QSVVNYEQKI QNAFKEVADA LALRQSLNDQ ISAQQRYLAS LQITLQRART LYQHGAVSYL       420
     EVLDAERSLF ATRQTLLDLN YARQVNEISL YTALGGGWQQ                             460
//

If you have problems or comments...

PBIL Back to PBIL home page