(data stored in ACNUC7421 zone)

EMBL: CP000247.PE6

CP000247.PE6         Location/Qualifiers
FT   CDS             5243..5530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0006"
FT                   /product="putative periplasmic protein YaaX"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68048"
FT                   /db_xref="InterPro:IPR019638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0T7"
FT                   /protein_id="ABG68048.1"
FT                   /translation="MQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDG
FT                   GHWRDHGWWKQHYEWRGNRWHPHGPPSSPRHNKHNDHRGDHRPGPDKHHR"
     MQSIVLALSL VLVAPMAAQA AEITLVPSVK LQIGDRDNRG YYWDGGHWRD HGWWKQHYEW        60
     RGNRWHPHGP PSSPRHNKHN DHRGDHRPGP DKHHR                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page