(data stored in ACNUC7421 zone)

EMBL: CP000247.PE600

CP000247.PE600       Location/Qualifiers
FT   CDS             complement(640893..642140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0608"
FT                   /product="putative transporter containing mechanosensitive
FT                   ion channel domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68636"
FT                   /db_xref="GOA:A0A454A225"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A225"
FT                   /protein_id="ABG68636.1"
FT                   /translation="MQDLISQVEDLAGIEIDHTTSMVMIFGIIFLTAVVVHIFLHWVVL
FT                   RTFEKRAIASSRLWLQIITQNKLFHRLAFTLQGIIVNIQAVFWLQKGTEAADILTTCAQ
FT                   LWIMMYALLSVFSLLDVILNLAQKFPAASQLPLKGIFQGIKLIGAILVGILMISLLIGQ
FT                   SPAILISGLGAMAAVLMLVFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGADGAVIDI
FT                   GLTTVKVRNWDNTITTIPTWSLVSDSFKNWSGMSASGGRRIKRSISIDVTSIRFLDEDE
FT                   MQRLNKAHLLKPYLTSRHQEINEWNRQQGSTESVLNLRRMTNIGTFRAYLNEYLRNHPR
FT                   IRKDMTLMVRQLAPGDNGLPLEIYAFTNTVVWLEYESIQADIFDHIFAIVEEFGLRLHQ
FT                   SPTGNDIRSLAGAFKQ"
     MQDLISQVED LAGIEIDHTT SMVMIFGIIF LTAVVVHIFL HWVVLRTFEK RAIASSRLWL        60
     QIITQNKLFH RLAFTLQGII VNIQAVFWLQ KGTEAADILT TCAQLWIMMY ALLSVFSLLD       120
     VILNLAQKFP AASQLPLKGI FQGIKLIGAI LVGILMISLL IGQSPAILIS GLGAMAAVLM       180
     LVFKDPILGL VAGIQLSAND MLKLGDWLEM PKYGADGAVI DIGLTTVKVR NWDNTITTIP       240
     TWSLVSDSFK NWSGMSASGG RRIKRSISID VTSIRFLDED EMQRLNKAHL LKPYLTSRHQ       300
     EINEWNRQQG STESVLNLRR MTNIGTFRAY LNEYLRNHPR IRKDMTLMVR QLAPGDNGLP       360
     LEIYAFTNTV VWLEYESIQA DIFDHIFAIV EEFGLRLHQS PTGNDIRSLA GAFKQ            415
//

If you have problems or comments...

PBIL Back to PBIL home page