(data stored in ACNUC7421 zone)

EMBL: CP000247.PE603

CP000247.PE603       Location/Qualifiers
FT   CDS             complement(643428..643676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0611"
FT                   /product="putative membrane protein YbdJ"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68639"
FT                   /db_xref="GOA:A0A454A232"
FT                   /db_xref="InterPro:IPR010590"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A232"
FT                   /protein_id="ABG68639.1"
FT                   /translation="MKHPLETLTTAAGILLMAFLSCLLLPAPALGLTLAQKLVTTFHLM
FT                   DLSQLYTVLFCLWFLVLGAIEYFVLRFIWRRWFSLAD"
     MKHPLETLTT AAGILLMAFL SCLLLPAPAL GLTLAQKLVT TFHLMDLSQL YTVLFCLWFL        60
     VLGAIEYFVL RFIWRRWFSL AD                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page