(data stored in ACNUC7421 zone)

EMBL: CP000247.PE604

CP000247.PE604       Location/Qualifiers
FT   CDS             complement(643742..644860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68640"
FT                   /db_xref="GOA:Q0TK91"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TK91"
FT                   /protein_id="ABG68640.1"
FT                   /translation="MPLPDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLIDTVKNQI
FT                   TAGEVKHDITESMLELATDVCRDINQAAGQFSAMQKVVLQAAADHHLEICGGGTHPFQK
FT                   WQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHVGCASGDDAIYLLHGLSRFVPHFIA
FT                   LSAASPYMQGTDTRFASSRPNIFSAFPDNGPMPWVSNWQQFEALFRCLSYTTMIDSIKD
FT                   LHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLIQATAHWLLTERPFKHQEKDYLMYK
FT                   FNRFQACRYGLEGVITDPHTGDRRSLTEATLRLLEKIAPSAHKIGASSAIEALHRQVVS
FT                   GLNEAQLMRDFVADGGSLIGLVKKHCEIWAGE"
     MPLPDFHVSE PFTLGIELEM QVVNPPGYDL SQDSSMLIDT VKNQITAGEV KHDITESMLE        60
     LATDVCRDIN QAAGQFSAMQ KVVLQAAADH HLEICGGGTH PFQKWQRQEV CDNERYQRTL       120
     ENFGYLIQQA TVFGQHVHVG CASGDDAIYL LHGLSRFVPH FIALSAASPY MQGTDTRFAS       180
     SRPNIFSAFP DNGPMPWVSN WQQFEALFRC LSYTTMIDSI KDLHWDIRPS PHFGTVEVRV       240
     MDTPLTLSHA VNMAGLIQAT AHWLLTERPF KHQEKDYLMY KFNRFQACRY GLEGVITDPH       300
     TGDRRSLTEA TLRLLEKIAP SAHKIGASSA IEALHRQVVS GLNEAQLMRD FVADGGSLIG       360
     LVKKHCEIWA GE                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page