(data stored in ACNUC7421 zone)

EMBL: CP000247.PE607

CP000247.PE607       Location/Qualifiers
FT   CDS             complement(646374..648623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0615"
FT                   /product="ferrienterobactin receptor precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68643"
FT                   /db_xref="GOA:A0A454A263"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A263"
FT                   /protein_id="ABG68643.1"
FT                   /translation="MNKKIHSLALLVNLGIYGVALPVLAEETSDNAVSHDDTIVVTAAE
FT                   QNLQAPGVSTITADEIRKNPVARDVSEIIRTMPGVNLTGNSTSGQRGNNRQIDIRGMGP
FT                   ENTLILIDGKPVSSRNSVRQGWRGERDTRGDTSWVPPEMIERIEVLRGPAAARYGNGAA
FT                   GGVVNIITKKGSGEWHGSWDAYFNAPEHKEEGATKRTNFSLTGPLGDEFSFRLYGNLDK
FT                   TQADAWDINQGHQSARAGTYATTLPAGREGVINKDINGVVRWDFAPLQSLELEAGYSRQ
FT                   GNLYAGDTQNTNSDAYTRSKYGDETNRLYRQNYSLTWNGGWDNGVTTSNWVQYEHTRNS
FT                   RIPEGLAGGTEGKFNEKAAQDFVDIDLDDVMLHSEVNLPIDFLVNQTLTLGTEWNQQRM
FT                   KDLSSNTQALTGTNTGGAIDGVSATDRSPYSKAEIFSLFAENNMELTDSTIVTPGLRFD
FT                   HHSIVGNNWSPALNISQSLGDDFTLKMGIARAYKAPSLYQTNPNYILYSKGQGCYASAG
FT                   GCYLQGNDDLKAETSINKEIGLEFKRDGWLAGVTWFRNDYRNKIEAGYVAVGQNAVGTD
FT                   LYQWDNVPKAVVEGLEGSLNVPVSETVMWTNNITYMLKSENKTTGDRLSIIPEYTLNST
FT                   LSWQAREDLSMQTTFTWYGKQQPKKYNYKGQPAVGPETKEISPYSIVGLSATWDVTKNV
FT                   SLTGGVDNLFDKRLWRAGNAQTTGDLAGANYIAGAGAYTYNEPGRTWYMSINTHF"
     MNKKIHSLAL LVNLGIYGVA LPVLAEETSD NAVSHDDTIV VTAAEQNLQA PGVSTITADE        60
     IRKNPVARDV SEIIRTMPGV NLTGNSTSGQ RGNNRQIDIR GMGPENTLIL IDGKPVSSRN       120
     SVRQGWRGER DTRGDTSWVP PEMIERIEVL RGPAAARYGN GAAGGVVNII TKKGSGEWHG       180
     SWDAYFNAPE HKEEGATKRT NFSLTGPLGD EFSFRLYGNL DKTQADAWDI NQGHQSARAG       240
     TYATTLPAGR EGVINKDING VVRWDFAPLQ SLELEAGYSR QGNLYAGDTQ NTNSDAYTRS       300
     KYGDETNRLY RQNYSLTWNG GWDNGVTTSN WVQYEHTRNS RIPEGLAGGT EGKFNEKAAQ       360
     DFVDIDLDDV MLHSEVNLPI DFLVNQTLTL GTEWNQQRMK DLSSNTQALT GTNTGGAIDG       420
     VSATDRSPYS KAEIFSLFAE NNMELTDSTI VTPGLRFDHH SIVGNNWSPA LNISQSLGDD       480
     FTLKMGIARA YKAPSLYQTN PNYILYSKGQ GCYASAGGCY LQGNDDLKAE TSINKEIGLE       540
     FKRDGWLAGV TWFRNDYRNK IEAGYVAVGQ NAVGTDLYQW DNVPKAVVEG LEGSLNVPVS       600
     ETVMWTNNIT YMLKSENKTT GDRLSIIPEY TLNSTLSWQA REDLSMQTTF TWYGKQQPKK       660
     YNYKGQPAVG PETKEISPYS IVGLSATWDV TKNVSLTGGV DNLFDKRLWR AGNAQTTGDL       720
     AGANYIAGAG AYTYNEPGRT WYMSINTHF                                         749
//

If you have problems or comments...

PBIL Back to PBIL home page