(data stored in ACNUC7421 zone)

EMBL: CP000247.PE614

CP000247.PE614       Location/Qualifiers
FT   CDS             complement(657313..658329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0622"
FT                   /product="ferric enterobactin transport system permease
FT                   protein FepD"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68650"
FT                   /db_xref="GOA:A0A454A278"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A278"
FT                   /protein_id="ABG68650.1"
FT                   /translation="MEVRMSGSVAVTRAIAVPGLLLLLIIATALSLLIGAKSLPASVVL
FT                   EALSGTCQSADCTIVLDARLPRTLAGLLAGGALGLAGALMQTLTRNPLADPGLLGVNAG
FT                   ASFAIVLGAALFGYSSAQEQLAMAFAGALVASLIVAFTGSQGGGQLSPVRLTLAGVALA
FT                   AVLEGLTSGIALLNPDVYDQLRFWQAGSLDIRNLHTLKVVLIPVLTAGATALLLSRALN
FT                   SLSLGSDTATALGSRVARTQLIGLLAITVLCGSATAVVGPIAFIGLMMPHMARWLVGAD
FT                   HRWSLPVTLLTTPALLLFADIIGRVIVPGELRVSVVSAFIGAPVLIFLVRRKTRGGA"
     MEVRMSGSVA VTRAIAVPGL LLLLIIATAL SLLIGAKSLP ASVVLEALSG TCQSADCTIV        60
     LDARLPRTLA GLLAGGALGL AGALMQTLTR NPLADPGLLG VNAGASFAIV LGAALFGYSS       120
     AQEQLAMAFA GALVASLIVA FTGSQGGGQL SPVRLTLAGV ALAAVLEGLT SGIALLNPDV       180
     YDQLRFWQAG SLDIRNLHTL KVVLIPVLTA GATALLLSRA LNSLSLGSDT ATALGSRVAR       240
     TQLIGLLAIT VLCGSATAVV GPIAFIGLMM PHMARWLVGA DHRWSLPVTL LTTPALLLFA       300
     DIIGRVIVPG ELRVSVVSAF IGAPVLIFLV RRKTRGGA                               338
//

If you have problems or comments...

PBIL Back to PBIL home page