(data stored in ACNUC7421 zone)

EMBL: CP000247.PE621

CP000247.PE621       Location/Qualifiers
FT   CDS             665242..665655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0629"
FT                   /product="hypothetical protein YbdB"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68657"
FT                   /db_xref="GOA:A0A454A252"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR026576"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A252"
FT                   /protein_id="ABG68657.1"
FT                   /translation="MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDTR
FT                   THQPFGLLHGGASAALAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQP
FT                   LHLGRQNQSWEIVVFDEQGRRCCTCRLGTAVLG"
     MIWKRHLTLD ELNATSDNTM VAHLGIVYTR LGDDVLEAEM PVDTRTHQPF GLLHGGASAA        60
     LAETLGSMAG FMMTRDGQCV VGTELNATHH RPVSEGKVRG VCQPLHLGRQ NQSWEIVVFD       120
     EQGRRCCTCR LGTAVLG                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page