(data stored in ACNUC7421 zone)

EMBL: CP000247.PE623

CP000247.PE623       Location/Qualifiers
FT   CDS             668053..668250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0631"
FT                   /product="hypothetical protein YbdD"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68659"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A260"
FT                   /protein_id="ABG68659.1"
FT                   /translation="MFDSLAKAGKYLGQAAKLMIGMPDYDNYVEHMRVNHPDQTPMTYE
FT                   EFFRERQDARYGGKGGARCC"
     MFDSLAKAGK YLGQAAKLMI GMPDYDNYVE HMRVNHPDQT PMTYEEFFRE RQDARYGGKG        60
     GARCC                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page