(data stored in ACNUC7421 zone)

EMBL: CP000247.PE642

CP000247.PE642       Location/Qualifiers
FT   CDS             686695..688353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0650"
FT                   /product="sensor kinase DpiB"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68678"
FT                   /db_xref="GOA:A0A454A279"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A279"
FT                   /protein_id="ABG68678.1"
FT                   /translation="MLQLKENKQFAFFQRLAFPLRIFLLILVFSIFVIAALAQYFTASF
FT                   EDYLTLHVRDMAMNQAKIIASNDSIISAVKTRDYKRLATIADKLQRDTDFDYVVIGDRH
FT                   SIRLYHPNPEKIGYPMQFTKPGALEKGESYFITGKGSIGMAMRAKTPIFDDDGKVIGVV
FT                   SIGYLVSKIDSWRAEFLLPMAGVFVVLLGILMLLSWFLAAHIRRQMMGMEPKQIARVVR
FT                   QQEALFSSVYEGLIAVDPHGYITAINRNARKMLGLSSPGRQWLGKPIAEVVRPADFFTE
FT                   QIDEKRQDVVANFNGLSVIANREAIRSGDDLLGAIISFRSKDEISTLNAQLTQIKQYVE
FT                   SLRTLRHEHLNWMSTLNGLLQMKEYDRVLAMVQGESQAQQQLIDSLREAFADRQVAGLL
FT                   FGKVQRARELGLKMVIVPGSQLSQLPPGLDSTEFAAIVGNLLDNAFEASLRSDEGNKIV
FT                   ELFLSDEGDDVVIEVADQGCGVPESLRDKIFEQGVSTRADEPGEHGIGLYLIASYVTRC
FT                   GGVITLEDNDPCGTLFSIYIPKVKPNDSSINPIDR"
     MLQLKENKQF AFFQRLAFPL RIFLLILVFS IFVIAALAQY FTASFEDYLT LHVRDMAMNQ        60
     AKIIASNDSI ISAVKTRDYK RLATIADKLQ RDTDFDYVVI GDRHSIRLYH PNPEKIGYPM       120
     QFTKPGALEK GESYFITGKG SIGMAMRAKT PIFDDDGKVI GVVSIGYLVS KIDSWRAEFL       180
     LPMAGVFVVL LGILMLLSWF LAAHIRRQMM GMEPKQIARV VRQQEALFSS VYEGLIAVDP       240
     HGYITAINRN ARKMLGLSSP GRQWLGKPIA EVVRPADFFT EQIDEKRQDV VANFNGLSVI       300
     ANREAIRSGD DLLGAIISFR SKDEISTLNA QLTQIKQYVE SLRTLRHEHL NWMSTLNGLL       360
     QMKEYDRVLA MVQGESQAQQ QLIDSLREAF ADRQVAGLLF GKVQRARELG LKMVIVPGSQ       420
     LSQLPPGLDS TEFAAIVGNL LDNAFEASLR SDEGNKIVEL FLSDEGDDVV IEVADQGCGV       480
     PESLRDKIFE QGVSTRADEP GEHGIGLYLI ASYVTRCGGV ITLEDNDPCG TLFSIYIPKV       540
     KPNDSSINPI DR                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page