(data stored in ACNUC7421 zone)

EMBL: CP000247.PE645

CP000247.PE645       Location/Qualifiers
FT   CDS             691015..691575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0653"
FT                   /product="CrcA protein"
FT                   /note="putative antimicrobial peptide resistance and lipid
FT                   A acylation protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68681"
FT                   /db_xref="GOA:Q0TK50"
FT                   /db_xref="InterPro:IPR009746"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TK50"
FT                   /protein_id="ABG68681.1"
FT                   /translation="MKVSKYVAIFFFVFIQLISVGKVFANADEWMTTFRENIAQTWQQP
FT                   EHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGQSRWDEKGNWHGLYAMAFKDSWN
FT                   KWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPATF
FT                   QMTYIPGTYNNGNVYFAWMRFQF"
     MKVSKYVAIF FFVFIQLISV GKVFANADEW MTTFRENIAQ TWQQPEHYDL YIPAITWHAR        60
     FAYDKEKTDR YNERPWGGGF GQSRWDEKGN WHGLYAMAFK DSWNKWEPIA GYGWESTWRP       120
     LADENFHLGL GFTAGVTARD NWNYIPLPVL LPLASVGYGP ATFQMTYIPG TYNNGNVYFA       180
     WMRFQF                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page