(data stored in ACNUC7421 zone)

EMBL: CP000247.PE647

CP000247.PE647       Location/Qualifiers
FT   CDS             complement(692013..692396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0655"
FT                   /product="protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68683"
FT                   /db_xref="GOA:Q0TK48"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TK48"
FT                   /protein_id="ABG68683.1"
FT                   /translation="MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGA
FT                   FIIGMGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVF
FT                   VNLLGSFAMTALAFWLFSASTAH"
     MLQLLLAVFI GGGTGSVARW LLSMRFNPLH QAIPLGTLAA NLIGAFIIGM GFAWFSRMTN        60
     IDPVWKVLIT TGFCGGLTTF STFSAEVVFL LQEGRFGWAL LNVFVNLLGS FAMTALAFWL       120
     FSASTAH                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page