(data stored in ACNUC7421 zone)

EMBL: CP000247.PE658

CP000247.PE658       Location/Qualifiers
FT   CDS             complement(702109..702576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0666"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68694"
FT                   /db_xref="GOA:Q0TK37"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TK37"
FT                   /protein_id="ABG68694.1"
FT                   /translation="MKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGK
FT                   NADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLAAELERWKLDGRDVSLLIGG
FT                   PEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE"
     MKLQLVAVGT KMPDWVQTGF TEYLRRFPKD MPFELIEIPA GKRGKNADIK RILDKEGEQM        60
     LAAAGKNRIV TLDIPGKPWD TPQLAAELER WKLDGRDVSL LIGGPEGLSP ACKAAAEQSW       120
     SLSALTLPHP LVRVLVAESL YRAWSITTNH PYHRE                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page