(data stored in ACNUC7421 zone)

EMBL: CP000247.PE659

CP000247.PE659       Location/Qualifiers
FT   CDS             complement(702580..702897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68695"
FT                   /db_xref="GOA:A0A454A286"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A286"
FT                   /protein_id="ABG68695.1"
FT                   /translation="MQGKALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSS
FT                   RHVMSIADHVVQESRAAGLLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLW
FT                   S"
     MQGKALQDFV IDKIDDLKGQ DIIALDVQGK SSITDCMIIC TGTSSRHVMS IADHVVQESR        60
     AAGLLPLGVE GENSADWIVV DLGDVIVHVM QEESRRLYEL EKLWS                       105
//

If you have problems or comments...

PBIL Back to PBIL home page