(data stored in ACNUC7421 zone)

EMBL: CP000247.PE66

CP000247.PE66        Location/Qualifiers
FT   CDS             72461..73309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68106"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0X0"
FT                   /protein_id="ABG68106.1"
FT                   /translation="MSKRNDITDGIFATTKKYGLVYTEELGWIDLGHAQGQDARILKRK
FT                   LEQEHFSTYYDEFHDWYFPVDYHQEMGIRKKILGVDLTFHTGVYTKVMVRSCLSPTLKA
FT                   RVALTLMYGTAKRFEAWQNSFIFNWYTDSGFSAEDLVSDLIGFYRVFGTGPDPLLLAKP
FT                   LSYTKALQIWDTYGAPGNFKNTEFTPFLFTTHPPFKKNQLIKKKLPEWLNYIKPLDESF
FT                   STLLYNQYNNRPVTNYYKDKNRINHELYSSLSSSGAIKFSESPFERPLFLFLNPHYPHR
FT                   S"
     MSKRNDITDG IFATTKKYGL VYTEELGWID LGHAQGQDAR ILKRKLEQEH FSTYYDEFHD        60
     WYFPVDYHQE MGIRKKILGV DLTFHTGVYT KVMVRSCLSP TLKARVALTL MYGTAKRFEA       120
     WQNSFIFNWY TDSGFSAEDL VSDLIGFYRV FGTGPDPLLL AKPLSYTKAL QIWDTYGAPG       180
     NFKNTEFTPF LFTTHPPFKK NQLIKKKLPE WLNYIKPLDE SFSTLLYNQY NNRPVTNYYK       240
     DKNRINHELY SSLSSSGAIK FSESPFERPL FLFLNPHYPH RS                          282
//

If you have problems or comments...

PBIL Back to PBIL home page