(data stored in ACNUC7421 zone)

EMBL: CP000247.PE67

CP000247.PE67        Location/Qualifiers
FT   CDS             73316..73738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68107"
FT                   /db_xref="GOA:A0A454A0W6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0W6"
FT                   /protein_id="ABG68107.1"
FT                   /translation="MSKYIYILLSFLVLFFIFFYAYISLMSKEHHYTQHELSPFFLYTP
FT                   ESLRNLPNISNVAEYSYYYNVDDMQTRVIVTWRNIDNIFLQKAKLIDFLKRMGPSLQND
FT                   CIWFFHDKSDYANNFQRYCIIEHRDSLQVEYFETIE"
     MSKYIYILLS FLVLFFIFFY AYISLMSKEH HYTQHELSPF FLYTPESLRN LPNISNVAEY        60
     SYYYNVDDMQ TRVIVTWRNI DNIFLQKAKL IDFLKRMGPS LQNDCIWFFH DKSDYANNFQ       120
     RYCIIEHRDS LQVEYFETIE                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page