(data stored in ACNUC7421 zone)

EMBL: CP000247.PE70

CP000247.PE70        Location/Qualifiers
FT   CDS             complement(75453..77063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0070"
FT                   /product="thiamine transport system permease protein ThiP"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68110"
FT                   /db_xref="GOA:A0A454A0W8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0W8"
FT                   /protein_id="ABG68110.1"
FT                   /translation="MATRRQPLIPGWLIPGVSAATLVVAVALAAFLALWWNAPQGDWVA
FT                   VWQDSYLWHVVRFSFWQAFLSAQLSVVPAIFLARALYRRHFPGRQMLLRLCAMTLILPV
FT                   LVAVFGILSVYGRQGWLASLWQSLGLEWTFSPYGLQGILLAHVFFNLPMASRLLLQALE
FT                   NIPGEQRQLAAQLGMRGWHFFRFVEWPWLRRQIPPVAALIFMLCFASFATVLSLGGGPQ
FT                   ATTIELAIYQALSYDYDPARAAMLALIQMVCCLGLVLLSQRLSKAIAPGTTLLQGWRDP
FT                   DDRLHSRICDTALIVLALLLLLPPLLAVIVDGVNRQLPEVLAQPVLWQALWTSLRIALA
FT                   AGVLCVVLTMMLLWSSRELRARQKMLAGQALEMSGMLILAMPGIVLATGFFLLLNNTIG
FT                   LPQSADGIVIFTNALMAIPYALKVLENPMRDITARYSMLCQSLGIEGWSRLKVVELRAL
FT                   KRPLAQALAFACVLSIGDFGVVALFGNDDFRTLPFYLYQQIGSYRSQDGAVTALILLLL
FT                   CFLLFTVIEKIPGRNVKTD"
     MATRRQPLIP GWLIPGVSAA TLVVAVALAA FLALWWNAPQ GDWVAVWQDS YLWHVVRFSF        60
     WQAFLSAQLS VVPAIFLARA LYRRHFPGRQ MLLRLCAMTL ILPVLVAVFG ILSVYGRQGW       120
     LASLWQSLGL EWTFSPYGLQ GILLAHVFFN LPMASRLLLQ ALENIPGEQR QLAAQLGMRG       180
     WHFFRFVEWP WLRRQIPPVA ALIFMLCFAS FATVLSLGGG PQATTIELAI YQALSYDYDP       240
     ARAAMLALIQ MVCCLGLVLL SQRLSKAIAP GTTLLQGWRD PDDRLHSRIC DTALIVLALL       300
     LLLPPLLAVI VDGVNRQLPE VLAQPVLWQA LWTSLRIALA AGVLCVVLTM MLLWSSRELR       360
     ARQKMLAGQA LEMSGMLILA MPGIVLATGF FLLLNNTIGL PQSADGIVIF TNALMAIPYA       420
     LKVLENPMRD ITARYSMLCQ SLGIEGWSRL KVVELRALKR PLAQALAFAC VLSIGDFGVV       480
     ALFGNDDFRT LPFYLYQQIG SYRSQDGAVT ALILLLLCFL LFTVIEKIPG RNVKTD           536
//

If you have problems or comments...

PBIL Back to PBIL home page