(data stored in ACNUC7421 zone)

EMBL: CP000247.PE85

CP000247.PE85        Location/Qualifiers
FT   CDS             92350..92715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0085"
FT                   /product="cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68125"
FT                   /db_xref="GOA:A0A454A0X3"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0X3"
FT                   /protein_id="ABG68125.1"
FT                   /translation="MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
     MISRVTEALS KVKGSMGSHE RHALPGVIGD DLLRFGKLPL CLFICIILTA VTVVTTAHHT        60
     RLLTAQREQL VLERDALDIE WRNLILEENA LGDHSRVERI ATEKLQMQHV DPSQENIVVQ       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page