(data stored in ACNUC7421 zone)

EMBL: CP000247.PE95

CP000247.PE95        Location/Qualifiers
FT   CDS             104473..105303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0095"
FT                   /product="cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68135"
FT                   /db_xref="GOA:A0A454A0Y2"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0Y2"
FT                   /protein_id="ABG68135.1"
FT                   /translation="MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVV
FT                   LGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLP
FT                   WIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPDRTSKQVLPMLYGP
FT                   EGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ"
     MSQAALNTRN SEEEVSSRRN NGTRLAGILF LLTVLTTVLV SGWVVLGWME DAQRLPLSKL        60
     VLTGERHYTR NDDIRQSILA LGEPGTFMTQ DVNIIQTQIE QRLPWIKQVS VRKQWPDELK       120
     IHLVEYVPIA RWNDQHMVDA EGNTFSVPPD RTSKQVLPML YGPEGSANEV LQGYREMGQM       180
     LAKDRFTLKE AAMTARRSWQ LTLNNDIKLN LGRGDTMKRL ARFVELYPVL QQQAQTDGKR       240
     ISYVDLRYDS GAAVGWAPLP PEESTQQQNQ AQAEQQ                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page