(data stored in ACNUC7421 zone)

EMBL: CP000251.PE101

CP000251.PE101       Location/Qualifiers
FT   CDS             122813..124189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0102"
FT                   /product="peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79879"
FT                   /db_xref="GOA:Q2IM49"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79879.1"
FT                   /translation="MIASPLLVAALLTAAPAAAAPPPGDAPEIPYTMFTLGNGLTVILH
FT                   EDHTAPLVGVHVQYDVGSKDERPGRTGFAHLFEHLMFQGSAHLPKGEADRLVDAAGGEA
FT                   NGGTSPDSTVYWEQVPSGALEQMLFIEADRMGWMFPTLTQEKLDNQRDVVRNERRQSYE
FT                   MQPYGLVFEKLLANLWDPQFPYHWQTIGTHEDLEAATLADVKQFFERWYGPENAVLAIA
FT                   GDIDPARTRALVEKWFGPIPGKARPAHQAPAPKPLTAEQRVSMDDRVQLPRLYLAWQTP
FT                   RVFAPGDAALDVLSSVLSDGKSARLVKRLVMDEQIAQGVSAGQMSQALASMYLVVATPK
FT                   PGIPLERLEREIDEELARIAREPPSAEEVQRAKNKIEAGAVFGLEPVGGFGGRAASLAG
FT                   YYVRTGDPGYLAKDLARYRAVTPADVSEAARRFLRKDARVVLTVHPRPAAAGAAAGSAR
FT                   "
     MIASPLLVAA LLTAAPAAAA PPPGDAPEIP YTMFTLGNGL TVILHEDHTA PLVGVHVQYD        60
     VGSKDERPGR TGFAHLFEHL MFQGSAHLPK GEADRLVDAA GGEANGGTSP DSTVYWEQVP       120
     SGALEQMLFI EADRMGWMFP TLTQEKLDNQ RDVVRNERRQ SYEMQPYGLV FEKLLANLWD       180
     PQFPYHWQTI GTHEDLEAAT LADVKQFFER WYGPENAVLA IAGDIDPART RALVEKWFGP       240
     IPGKARPAHQ APAPKPLTAE QRVSMDDRVQ LPRLYLAWQT PRVFAPGDAA LDVLSSVLSD       300
     GKSARLVKRL VMDEQIAQGV SAGQMSQALA SMYLVVATPK PGIPLERLER EIDEELARIA       360
     REPPSAEEVQ RAKNKIEAGA VFGLEPVGGF GGRAASLAGY YVRTGDPGYL AKDLARYRAV       420
     TPADVSEAAR RFLRKDARVV LTVHPRPAAA GAAAGSAR                               458
//

If you have problems or comments...

PBIL Back to PBIL home page