(data stored in ACNUC7421 zone)

EMBL: CP000251.PE106

CP000251.PE106       Location/Qualifiers
FT   CDS             complement(128615..130108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0107"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79884"
FT                   /db_xref="GOA:Q2IM51"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79884.1"
FT                   /translation="MTLRLKLFVLIAGVIIFAMSGVTAVALWRELVRGQELLLREGVAL
FT                   ASTTATGASHWVREGGVDPGGPEALPALLERLVSSAPLDRAWIVDSAGKVLACVSRTGE
FT                   PCPDGVPPTEFQAADWPLQTLSRLVRPEGIVASAPIVRAGAVVGAVRVDFTHEEVVGAA
FT                   RDLAWGAAAVAAFWIALGHLLAAIFIRQVTQPLVSLASAAESLAEERGVRLEEPEDREL
FT                   VDLVRAFNHMSARLDERRAENQRLIAELEERVAQKTREVLRADRLATLGGIAAGFAHEL
FT                   GNSLNVIRGYAAVTSRELPDDSPHRSDVEAIRREVTRAAGLIERFLVFARARTVHPLVQ
FT                   PVEPILREAVEVLGPAAAHAKVERAVEVEPGLPELLADAELLRQAFLNLGVNAVQAMQD
FT                   RGGKLTVRALREPGGLVVEFQDTGPGIDPDAAAHVFEPFFTTKATGTGLGLAIVRQAAE
FT                   AHGGTVEVAGAPGAGATFRVHLPAAEAGAAADAAAGGAG"
     MTLRLKLFVL IAGVIIFAMS GVTAVALWRE LVRGQELLLR EGVALASTTA TGASHWVREG        60
     GVDPGGPEAL PALLERLVSS APLDRAWIVD SAGKVLACVS RTGEPCPDGV PPTEFQAADW       120
     PLQTLSRLVR PEGIVASAPI VRAGAVVGAV RVDFTHEEVV GAARDLAWGA AAVAAFWIAL       180
     GHLLAAIFIR QVTQPLVSLA SAAESLAEER GVRLEEPEDR ELVDLVRAFN HMSARLDERR       240
     AENQRLIAEL EERVAQKTRE VLRADRLATL GGIAAGFAHE LGNSLNVIRG YAAVTSRELP       300
     DDSPHRSDVE AIRREVTRAA GLIERFLVFA RARTVHPLVQ PVEPILREAV EVLGPAAAHA       360
     KVERAVEVEP GLPELLADAE LLRQAFLNLG VNAVQAMQDR GGKLTVRALR EPGGLVVEFQ       420
     DTGPGIDPDA AAHVFEPFFT TKATGTGLGL AIVRQAAEAH GGTVEVAGAP GAGATFRVHL       480
     PAAEAGAAAD AAAGGAG                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page