(data stored in ACNUC7421 zone)

EMBL: CP000251.PE107

CP000251.PE107       Location/Qualifiers
FT   CDS             complement(130105..131034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79885"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79885.1"
FT                   /translation="MRLSRNAKTVLAGLAALALVGLVAGFLRFKEFVDEDPRLCATCHR
FT                   ASPEFALWMGGTHRSVSCQRCHHSTPEQGLAMLRAFLAGQKPKGKHAEVEVGACAECHF
FT                   SHDPRWPQVGNSRGHRIHYQERGIACVRCHAASMHGFEPVAKKCEECHPKHAVGVEKMA
FT                   ALHCFACHEFLGSEQGLRPTRRDCMRCHTAQGIHAPMNEHGADHGAPMEMSCSACHRPH
FT                   RPEGQTLAACAECHGDDKMAKGGLHTHRGHRACLECHKPHTWTAEQADCLRCHPSGKAH
FT                   AEGTACTTCHAFVGAPLPSFPTEDGGVR"
     MRLSRNAKTV LAGLAALALV GLVAGFLRFK EFVDEDPRLC ATCHRASPEF ALWMGGTHRS        60
     VSCQRCHHST PEQGLAMLRA FLAGQKPKGK HAEVEVGACA ECHFSHDPRW PQVGNSRGHR       120
     IHYQERGIAC VRCHAASMHG FEPVAKKCEE CHPKHAVGVE KMAALHCFAC HEFLGSEQGL       180
     RPTRRDCMRC HTAQGIHAPM NEHGADHGAP MEMSCSACHR PHRPEGQTLA ACAECHGDDK       240
     MAKGGLHTHR GHRACLECHK PHTWTAEQAD CLRCHPSGKA HAEGTACTTC HAFVGAPLPS       300
     FPTEDGGVR                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page