(data stored in ACNUC7421 zone)

EMBL: CP000251.PE109

CP000251.PE109       Location/Qualifiers
FT   CDS             complement(133102..133410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79887"
FT                   /db_xref="GOA:Q2IM55"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79887.1"
FT                   /translation="MAQNKLPSLIGAGIGLALFLAVALLPALLYGGYAGLLLAGGIVGT
FT                   PVQPTLLVRGLIVFGMGLGVVGVASLFAVAGAAAGAAVGAILTIAGRRPVAQEQSGR"
     MAQNKLPSLI GAGIGLALFL AVALLPALLY GGYAGLLLAG GIVGTPVQPT LLVRGLIVFG        60
     MGLGVVGVAS LFAVAGAAAG AAVGAILTIA GRRPVAQEQS GR                          102
//

If you have problems or comments...

PBIL Back to PBIL home page