(data stored in ACNUC7421 zone)

EMBL: CP000251.PE111

CP000251.PE111       Location/Qualifiers
FT   CDS             complement(135428..136462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0112"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79889"
FT                   /db_xref="GOA:Q2IM60"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79889.1"
FT                   /translation="MLNFVHNILSRDLAIDLGTANTLIYIRGMGIVSNEPSVVAVQADG
FT                   RGSRRVLAVGKEAKEMLGRTPGNIVAIRPMKDGVIADFEVTAAMLKHFIQTAHNRKSFV
FT                   KPRIIIGIPSGITEVEKRAVREAAESAGAREVYLIEQPMAAAIGAGLPITEPSGNMIVD
FT                   IGGGTSDVAVISLGGIVYSRSVRVAGDKMDEAIIQHVKRKYNLLIGERTAELIKMGIGT
FT                   AYPTEEELTMDIKGRDLVAGVPRTLTVTSSEIREALAEPVNGVVEAVKVTLERTPPELA
FT                   GDIADRGIVLAGGGALLKNLDVLLREETGLPVFLAEDPLSAVVIGAGKALEELDILRQV
FT                   TAQG"
     MLNFVHNILS RDLAIDLGTA NTLIYIRGMG IVSNEPSVVA VQADGRGSRR VLAVGKEAKE        60
     MLGRTPGNIV AIRPMKDGVI ADFEVTAAML KHFIQTAHNR KSFVKPRIII GIPSGITEVE       120
     KRAVREAAES AGAREVYLIE QPMAAAIGAG LPITEPSGNM IVDIGGGTSD VAVISLGGIV       180
     YSRSVRVAGD KMDEAIIQHV KRKYNLLIGE RTAELIKMGI GTAYPTEEEL TMDIKGRDLV       240
     AGVPRTLTVT SSEIREALAE PVNGVVEAVK VTLERTPPEL AGDIADRGIV LAGGGALLKN       300
     LDVLLREETG LPVFLAEDPL SAVVIGAGKA LEELDILRQV TAQG                        344
//

If you have problems or comments...

PBIL Back to PBIL home page