(data stored in ACNUC7421 zone)

EMBL: CP000251.PE117

CP000251.PE117       Location/Qualifiers
FT   CDS             complement(142491..142937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0118"
FT                   /product="SSU ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79895"
FT                   /db_xref="GOA:Q2IM63"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79895.1"
FT                   /translation="MAETKQLVREYETIYLLKSETPDEQVDEIKERLRGVVSRQGGKVI
FT                   RFTNQGKRKTAFPVAKNAKALYMHCLYIGKPGLVTELERNLKMIDVVTKFQSVKLADGV
FT                   DFDARQVEADVKIQAVDDEQKPREERPEGGEEPFEAEAPEGQEE"
     MAETKQLVRE YETIYLLKSE TPDEQVDEIK ERLRGVVSRQ GGKVIRFTNQ GKRKTAFPVA        60
     KNAKALYMHC LYIGKPGLVT ELERNLKMID VVTKFQSVKL ADGVDFDARQ VEADVKIQAV       120
     DDEQKPREER PEGGEEPFEA EAPEGQEE                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page