(data stored in ACNUC7421 zone)

EMBL: CP000251.PE119

CP000251.PE119       Location/Qualifiers
FT   CDS             complement(143631..144353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0120"
FT                   /product="LSU ribosomal protein L25P"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79897"
FT                   /db_xref="GOA:Q2IM61"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79897.1"
FT                   /translation="MAENVLSAQKRTEQGKGPARRLRQQGLIPAVVYGGKREPTHVALD
FT                   PATLLKAIETPHKFNTLLELQVEGASKHVLFKDYTVDPVTRKLLHADFLEVSMDQPVKV
FT                   NVPVVTVGRAAGVAEGGILSVAAHAIVVEALPNKIPVRIEVDVTELKIGRSLHVSELKA
FT                   PEGCKFKFQTDYVVVFVAVPEKEEVAAPVAAAVPGAAPAEGAAPAAGAAAPAAGAAPAA
FT                   GAAPAKGGEAKGGDKGKK"
     MAENVLSAQK RTEQGKGPAR RLRQQGLIPA VVYGGKREPT HVALDPATLL KAIETPHKFN        60
     TLLELQVEGA SKHVLFKDYT VDPVTRKLLH ADFLEVSMDQ PVKVNVPVVT VGRAAGVAEG       120
     GILSVAAHAI VVEALPNKIP VRIEVDVTEL KIGRSLHVSE LKAPEGCKFK FQTDYVVVFV       180
     AVPEKEEVAA PVAAAVPGAA PAEGAAPAAG AAAPAAGAAP AAGAAPAKGG EAKGGDKGKK       240
//

If you have problems or comments...

PBIL Back to PBIL home page