(data stored in ACNUC7421 zone)

EMBL: CP000251.PE122

CP000251.PE122       Location/Qualifiers
FT   CDS             complement(145987..146928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0123"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79900"
FT                   /db_xref="GOA:Q2IM67"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79900.1"
FT                   /translation="MRLVTLAPAKVNLVLRVGPVRADGYHDLRTLMVPLDLGDRVDVRV
FT                   SARRGPVRCTVPGRPELHGPENLAARAAEAFRRRFGVDRAVSIRIEKRTPVTAGLGGGS
FT                   SDAAAVLRCLARAFRVRDRAALAALALEIGSDVPFFLGPGPAWAAGRGERLSPADVPPL
FT                   DLVLVYPADPSLAIRAGDAYRWLDEARAGGPQAPRRLGRPGRWRPSLLGNDLQAPCVAR
FT                   KPALQALLGLLVGAGATAAIMSGSGPTVFGVFPGRGAARGAALAIQGRAKGGAAGVQVL
FT                   LARTVRRHPRVSPWRSPRSASSPSTRRSSRPT"
     MRLVTLAPAK VNLVLRVGPV RADGYHDLRT LMVPLDLGDR VDVRVSARRG PVRCTVPGRP        60
     ELHGPENLAA RAAEAFRRRF GVDRAVSIRI EKRTPVTAGL GGGSSDAAAV LRCLARAFRV       120
     RDRAALAALA LEIGSDVPFF LGPGPAWAAG RGERLSPADV PPLDLVLVYP ADPSLAIRAG       180
     DAYRWLDEAR AGGPQAPRRL GRPGRWRPSL LGNDLQAPCV ARKPALQALL GLLVGAGATA       240
     AIMSGSGPTV FGVFPGRGAA RGAALAIQGR AKGGAAGVQV LLARTVRRHP RVSPWRSPRS       300
     ASSPSTRRSS RPT                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page